Sar1aProtein[10114][100µg]CatalogNumber:10114ProductName:Sar1aProteinSynonyms:SAR1homologA,SAR1,Sara,SARA1,Masra2Source:Human,recombinantfulllength,His6-tagExpressionHost:E

詳細介紹

Sar1a Protein [10114]
[100 µg]

Catalog Number: 10114

Product Name: Sar1a Protein

Synonyms: SAR1 homolog A, SAR1, Sara, SARA1, Masra2

Source: Human, recombinant full length, His6-tag

Expression Host: E. coli

Molecular Weight: 22 kDa

Purity: >95% by SDS-PAGE

Introduction: Small GTPases are a super-family of cellular signaling regulators. Sar1 is a member of these small GTPases. Sar1 functions as a molecular switch to control protein–protein and protein–lipid interactions that direct vesicle budding from the ER.

Amino Acid Sequence (1-198)

MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIA
GMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGN
KIDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions:
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Sar1a was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.

References:
1. He, H. et al., Gene Expr. 10: 231-242, 2002.
2. Jones, B. et al., Nature Genet. 34: 29-31, 2003.
3. South, S. T. et al., J. Cell Biol. 149: 1345-1359, 2000.

Datasheet:

Related Products
Catalog#	Name	Size	Price
	Active Sar1-GTP Monoclonal Antibody	30 μL	￥4800
	Sar1 Activation Assay Kit	20 assays	￥6800
	Anti-Sar1 Mouse Monoclonal Antibody	100 μL	￥2800
	Anti-Sar1a Rabbit Polyclonal Antibody	100 μL	￥2600